PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.1KG488800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 229aa    MW: 24449 Da    PI: 10.4129
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.1KG488800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB105.34.1e-3361148693
                NF-YB   6 rflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93 
                          + lP+an++r+m++v+P+  k+s  ak+++++c++ef++fv++eas+++++++r+ ++++d+  a  tlG++dyvep+++y+++yre 
  Pavir.1KG488800.1.p  61 AGLPMANLVRLMRQVIPKGVKVSAGAKHLTHDCAVEFVGFVAGEASEQAREQHRRIVSPEDFTRASQTLGLDDYVEPMSTYIRRYREH 148
                          569***********************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.0E-2461149IPR009072Histone-fold
PfamPF008085.4E-1362122IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamilySSF471133.46E-1963149IPR009072Histone-fold
PRINTSPR006153.8E-590108No hitNo description
PRINTSPR006153.8E-5128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MDKALRSPVI TKLHKIIERM GRKAKRGGAK QGVRDAGKAK VAPADRASPG GEGGSASAAA  60
AGLPMANLVR LMRQVIPKGV KVSAGAKHLT HDCAVEFVGF VAGEASEQAR EQHRRIVSPE  120
DFTRASQTLG LDDYVEPMST YIRRYREHHH IAAGYGGFVT RAPAVVTATA AAAPVTAPGV  180
PCFSDEEMQH PSSMVPPPNG EPRWRGEPRP WLHWIHVRVG SVACMAVQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-2163147993NF-YB
4csr_A4e-21631471094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B4e-21631471094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432570.0AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701062.11e-65PREDICTED: nuclear transcription factor Y subunit B-1-like
TrEMBLK3YVP36e-61K3YVP3_SETIT; Uncharacterized protein
STRINGSi018339m2e-60(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136592631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47640.12e-23nuclear factor Y, subunit B2